Lineage for d1fc1b1 (1fc1 B:238-341)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293085Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1293086Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1293123Domain d1fc1b1: 1fc1 B:238-341 [21522]
    Other proteins in same PDB: d1fc1a2, d1fc1b2
    part of a Fc

Details for d1fc1b1

PDB Entry: 1fc1 (more details), 2.9 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
PDB Compounds: (B:) fc fragment

SCOPe Domain Sequences for d1fc1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc1b1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1fc1b1:

Click to download the PDB-style file with coordinates for d1fc1b1.
(The format of our PDB-style files is described here.)

Timeline for d1fc1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc1b2