Lineage for d3qfsa1 (3qfs A:246-521)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793459Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2793480Protein automated matches [227066] (2 species)
    not a true protein
  7. 2793481Species Human (Homo sapiens) [TaxId:9606] [226187] (8 PDB entries)
  8. 2793483Domain d3qfsa1: 3qfs A:246-521 [215216]
    Other proteins in same PDB: d3qfsa2
    automated match to d1ja1a1
    complexed with fad, nap

Details for d3qfsa1

PDB Entry: 3qfs (more details), 1.4 Å

PDB Description: Crystal Structure of NADPH-Cytochrome P450 Reductase (FAD/NADPH domain)
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfsa1 b.43.4.1 (A:246-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfp
cptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvve
arrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveyetka
grinkgvatnwlrakepvgenggralvpmfvrksqf

SCOPe Domain Coordinates for d3qfsa1:

Click to download the PDB-style file with coordinates for d3qfsa1.
(The format of our PDB-style files is described here.)

Timeline for d3qfsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfsa2