Lineage for d3qfpa2 (3qfp A:236-425)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858529Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 1858537Domain d3qfpa2: 3qfp A:236-425 [215215]
    automated match to d1qqma2
    complexed with po4

Details for d3qfpa2

PDB Entry: 3qfp (more details), 2.26 Å

PDB Description: Crystal structure of yeast Hsp70 (Bip/Kar2) ATPase domain
PDB Compounds: (A:) 78 kDa glucose-regulated protein homolog

SCOPe Domain Sequences for d3qfpa2:

Sequence, based on SEQRES records: (download)

>d3qfpa2 c.55.1.0 (A:236-425) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kehqiivydlgggtfdvsllsiengvfevqatsgdthlggedfdykivrqlikafkkkhg
idvsdnnkalaklkreaekakralssqmstrieidsfvdgidlsetltrakfeelnldlf
kktlkpvekvlqdsglekkdvddivlvggstripkvqqllesyfdgkkaskginpdeava
ygaavqagvl

Sequence, based on observed residues (ATOM records): (download)

>d3qfpa2 c.55.1.0 (A:236-425) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kehqiivydlgggtfdvsllsiengvfevqatsgdthlggedfdykivrqlikkkhgidv
sdnnkalaklkreaekakralssqmstrieidsfvdgidlsetltrakfeelnldlfkkt
lkpvekvlqdsglekkdvddivlvggstripkvqqllesyfdgkkaskginpdeavayga
avqagvl

SCOPe Domain Coordinates for d3qfpa2:

Click to download the PDB-style file with coordinates for d3qfpa2.
(The format of our PDB-style files is described here.)

Timeline for d3qfpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qfpa1