SCOPe 2.05: Domain d3qeue2: 3qeu E:118-245

Lineage for d3qeue2 (3qeu E:118-245)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d3qeue2: 3qeu E:118-245 [215209]
Other proteins in same PDB: d3qeua1, d3qeub1, d3qeud1, d3qeue1
automated match to d1qsee2
complexed with gol, li

Details for d3qeue2

PDB Entry: 3qeu (more details), 2.09 Å

PDB Description: the crystal structure of tcr dmf5

PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qeue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeue2 b.1.1.2 (E:118-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d3qeue2:

Click to download the PDB-style file with coordinates for d3qeue2.
(The format of our PDB-style files is described here.)

Timeline for d3qeue2: