Lineage for d3qeue1 (3qeu E:3-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032526Domain d3qeue1: 3qeu E:3-117 [215208]
    Other proteins in same PDB: d3qeua1, d3qeua2, d3qeub2, d3qeud1, d3qeud2, d3qeue2
    automated match to d1qrne1
    complexed with gol, li

Details for d3qeue1

PDB Entry: 3qeu (more details), 2.09 Å

PDB Description: the crystal structure of tcr dmf5
PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qeue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeue1 b.1.1.0 (E:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miagitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkge
vpdgysvsrantddfpltlasavpsqtsvyfcasslsfgteaffgqgtrltvved

SCOPe Domain Coordinates for d3qeue1:

Click to download the PDB-style file with coordinates for d3qeue1.
(The format of our PDB-style files is described here.)

Timeline for d3qeue1: