SCOPe 2.08: Domain d3qeue1: 3qeu E:3-117

Lineage for d3qeue1 (3qeu E:3-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qeue1: 3qeu E:3-117 [215208]
   Other proteins in same PDB: d3qeua1, d3qeua2, d3qeub2, d3qeud1, d3qeud2, d3qeue2
   automated match to d1qrne1
   complexed with gol, li

Details for d3qeue1

PDB Entry: 3qeu, 2.09 Å

PDB Description: the crystal structure of tcr dmf5

PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qeue1:

Sequence; same for both SEQRES and ATOM records:

>d3qeue1 b.1.1.0 (E:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miagitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkge
vpdgysvsrantddfpltlasavpsqtsvyfcasslsfgteaffgqgtrltvved

Timeline for d3qeue1:

• d3qeue1 first appeared in SCOPe 2.03
  
• d3qeue1 appears in SCOPe 2.07