Lineage for d3qeud1 (3qeu D:0-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742834Domain d3qeud1: 3qeu D:0-110 [215206]
    Other proteins in same PDB: d3qeua2, d3qeub1, d3qeub2, d3qeud2, d3qeue1, d3qeue2
    automated match to d1qrnd1
    complexed with gol, li

Details for d3qeud1

PDB Entry: 3qeu (more details), 2.09 Å

PDB Description: the crystal structure of tcr dmf5
PDB Compounds: (D:) DMF5 alpha chain

SCOPe Domain Sequences for d3qeud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qeud1 b.1.1.1 (D:0-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akeveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgr
ftaqlnkasqyvsllirdsqpsdsatylcavnfgggklifgqgtelsvkpn

SCOPe Domain Coordinates for d3qeud1:

Click to download the PDB-style file with coordinates for d3qeud1.
(The format of our PDB-style files is described here.)

Timeline for d3qeud1: