SCOPe 2.05: Domain d3qehh1: 3qeh H:2-106

Lineage for d3qehh1 (3qeh H:2-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3qehh1: 3qeh H:2-106 [215200]
   Other proteins in same PDB: d3qehb2, d3qehd2, d3qehf2, d3qehh2
   automated match to d1rhha1
   complexed with cl, gol, so4

Details for d3qehh1

PDB Entry: 3qeh, 2.59 Å

PDB Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody

PDB Compounds: (H:) Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain

SCOPe Domain Sequences for d3qehh1:

Sequence; same for both SEQRES and ATOM records:

>d3qehh1 b.1.1.0 (H:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnrat
gvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveik

Timeline for d3qehh1:

• d3qehh1 first appeared in SCOPe 2.03
  
• d3qehh1 appears in SCOPe 2.04
  
• d3qehh1 appears in SCOPe 2.06
  
• d3qehh1 appears in the current release, SCOPe 2.08