Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d1fc1a1: 1fc1 A:238-341 [21520] Other proteins in same PDB: d1fc1a2, d1fc1b2 part of a Fc |
PDB Entry: 1fc1 (more details), 2.9 Å
SCOPe Domain Sequences for d1fc1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc1a1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1fc1a1: