Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d3qehf1: 3qeh F:1-106 [215198] Other proteins in same PDB: d3qehb2, d3qehd2, d3qehf2, d3qehh2 automated match to d1rhha1 complexed with cl, gol, so4 |
PDB Entry: 3qeh (more details), 2.59 Å
SCOPe Domain Sequences for d3qehf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qehf1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqsplslpvtpgeaasiscrssqsllhtngfqyldwylqkpgqspqlliylgsnra tgvphrfsgsgsgteftlkisrveaedvgvyycmqakesptfgqgtkveik
Timeline for d3qehf1: