SCOPe 2.08: Domain d3qehd2: 3qeh D:107-210

Lineage for d3qehd2 (3qeh D:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3qehd2: 3qeh D:107-210 [215197]
   Other proteins in same PDB: d3qehb1, d3qehd1, d3qehe_, d3qehf1, d3qehh1
   automated match to d1rhha2
   complexed with cl, gol, so4

Details for d3qehd2

PDB Entry: 3qeh, 2.59 Å

PDB Description: Crystal structure of human N12-i15, an ADCC and non-neutralizing anti-HIV-1 Env antibody

PDB Compounds: (D:) Fab fragment of human anti-HIV-1 Env antibody N12-i15,light chain

SCOPe Domain Sequences for d3qehd2:

Sequence; same for both SEQRES and ATOM records:

>d3qehd2 b.1.1.2 (D:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3qehd2:

• d3qehd2 first appeared in SCOPe 2.03
  
• d3qehd2 appears in SCOPe 2.07