| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
| Domain d1adqa2: 1adq A:342-443 [21519] Other proteins in same PDB: d1adqa1, d1adqh1, d1adqh2, d1adql1, d1adql2 part of a Fc |
PDB Entry: 1adq (more details), 3.15 Å
SCOP Domain Sequences for d1adqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adqa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsqeemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflysrltvdksrwqegnvfscsvmhealhnhytqkslsl
Timeline for d1adqa2:
View in 3DDomains from other chains: (mouse over for more information) d1adqh1, d1adqh2, d1adql1, d1adql2 |