Lineage for d3qdla_ (3qdl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963492Species Helicobacter pylori [TaxId:210] [187778] (2 PDB entries)
  8. 2963494Domain d3qdla_: 3qdl A: [215186]
    automated match to d3ge6a_
    complexed with fmn, gol

Details for d3qdla_

PDB Entry: 3qdl (more details), 2 Å

PDB Description: Crystal structure of RdxA from Helicobacter pyroli
PDB Compounds: (A:) oxygen-insensitive nadph nitroreductase

SCOPe Domain Sequences for d3qdla_:

Sequence, based on SEQRES records: (download)

>d3qdla_ d.90.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mkfldqekrrqllnerhsckmfdshyefssteleeiaeiarlspssyntqpwhfvmvtdk
dlkkqiaahsyfneemiksasalmvvcslrpsellphghymqnlypesykvrvipsfaqm
lgvrfnhsmqrlesyileqcyiavgqicmgvslmgldsciiggfdplkvgevleerinkp
kiaclialgkrvaeasqksrkskvdaitwl

Sequence, based on observed residues (ATOM records): (download)

>d3qdla_ d.90.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mkfldqekrrqllnerhsckmfdshyefssteleeiaeiarlspssyntqpwhfvmvtdk
dlkkqiaahsyfneemiksasalmvvcslrpsellpmqrlesyileqcyiavgqicmgvs
lmgldsciiggfdplkvgevleerinkpkiaclialgkrvaeasqksrkskvdaitwl

SCOPe Domain Coordinates for d3qdla_:

Click to download the PDB-style file with coordinates for d3qdla_.
(The format of our PDB-style files is described here.)

Timeline for d3qdla_: