SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qd5b_ (3qd5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150675Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2150676Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2150728Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2150729Protein automated matches [191196] (8 species)
    not a true protein
  7. 2150733Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries)
  8. 2150736Domain d3qd5b_: 3qd5 B: [215185]
    automated match to d2vvpa_
    complexed with edo, iod

Details for d3qd5b_

PDB Entry: 3qd5 (more details), 1.9 Å

PDB Description: Crystal structure of a putative ribose-5-phosphate isomerase from Coccidioides immitis solved by combined iodide ion SAD and MR
PDB Compounds: (B:) putative ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3qd5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd5b_ c.121.1.0 (B:) automated matches {Coccidioides immitis [TaxId: 246410]}
tplpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaql
ikdgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvig
ielakrlagewltyrfdqksasaqkvqaisdyekkfvevn

SCOPe Domain Coordinates for d3qd5b_:

Click to download the PDB-style file with coordinates for d3qd5b_.
(The format of our PDB-style files is described here.)

Timeline for d3qd5b_: