Lineage for d3qd5b_ (3qd5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921985Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2921986Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2922038Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2922039Protein automated matches [191196] (11 species)
    not a true protein
  7. 2922046Species Coccidioides immitis [TaxId:246410] [226073] (3 PDB entries)
  8. 2922050Domain d3qd5b_: 3qd5 B: [215185]
    automated match to d2vvpa_
    complexed with edo, iod

Details for d3qd5b_

PDB Entry: 3qd5 (more details), 1.9 Å

PDB Description: crystal structure of a putative ribose-5-phosphate isomerase from coccidioides immitis solved by combined iodide ion sad and mr
PDB Compounds: (B:) putative ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3qd5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd5b_ c.121.1.0 (B:) automated matches {Coccidioides immitis [TaxId: 246410]}
tplpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaql
ikdgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvig
ielakrlagewltyrfdqksasaqkvqaisdyekkfvevn

SCOPe Domain Coordinates for d3qd5b_:

Click to download the PDB-style file with coordinates for d3qd5b_.
(The format of our PDB-style files is described here.)

Timeline for d3qd5b_: