Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries) |
Domain d1adqa1: 1adq A:238-341 [21518] Other proteins in same PDB: d1adqa2, d1adqh1, d1adqh2, d1adql1, d1adql2 part of a Fc |
PDB Entry: 1adq (more details), 3.15 Å
SCOP Domain Sequences for d1adqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adqa1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakg
Timeline for d1adqa1:
View in 3D Domains from other chains: (mouse over for more information) d1adqh1, d1adqh2, d1adql1, d1adql2 |