Lineage for d1adqa1 (1adq A:238-341)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365531Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 365532Species Human (Homo sapiens) [TaxId:9606] [88585] (20 PDB entries)
  8. 365548Domain d1adqa1: 1adq A:238-341 [21518]
    Other proteins in same PDB: d1adqa2, d1adqh1, d1adqh2, d1adql1, d1adql2
    part of a Fc

Details for d1adqa1

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqa1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn
styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakg

SCOP Domain Coordinates for d1adqa1:

Click to download the PDB-style file with coordinates for d1adqa1.
(The format of our PDB-style files is described here.)

Timeline for d1adqa1: