SCOP 1.59: Domain d1adqa1: 1adq A:238-341

Lineage for d1adqa1 (1adq A:238-341)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fc (human) IgG1 class [49120] (8 PDB entries)

8. Domain d1adqa1: 1adq A:238-341 [21518]
   Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adqa1

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqa1:

Sequence; same for both SEQRES and ATOM records:

>d1adqa1 b.1.1.2 (A:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn
styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakg

Timeline for d1adqa1:

• d1adqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1adqa1 appears in SCOP 1.57
  
• d1adqa1 appears in SCOP 1.61
  
• d1adqa1 appears in the current release, SCOPe 2.08