Lineage for d3qcvm2 (3qcv M:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758064Domain d3qcvm2: 3qcv M:108-213 [215178]
    Other proteins in same PDB: d3qcvl1, d3qcvm1
    automated match to d1t66c2
    complexed with 18l

Details for d3qcvm2

PDB Entry: 3qcv (more details), 2.51 Å

PDB Description: crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (18:2)
PDB Compounds: (M:) LT3015 antibody Fab fragment, light chain

SCOPe Domain Sequences for d3qcvm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qcvm2 b.1.1.0 (M:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3qcvm2:

Click to download the PDB-style file with coordinates for d3qcvm2.
(The format of our PDB-style files is described here.)

Timeline for d3qcvm2: