SCOPe 2.08: Domain d3qcvl2: 3qcv L:108-213

Lineage for d3qcvl2 (3qcv L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3qcvl2: 3qcv L:108-213 [215176]
   Other proteins in same PDB: d3qcvl1, d3qcvm1
   automated match to d1t66c2
   complexed with 18l

Details for d3qcvl2

PDB Entry: 3qcv, 2.51 Å

PDB Description: crystal structure of the lt3015 antibody fab fragment in complex with lysophosphatidic acid (18:2)

PDB Compounds: (L:) LT3015 antibody Fab fragment, light chain

SCOPe Domain Sequences for d3qcvl2:

Sequence; same for both SEQRES and ATOM records:

>d3qcvl2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3qcvl2:

• d3qcvl2 first appeared in SCOPe 2.03
  
• d3qcvl2 appears in SCOPe 2.07