SCOPe 2.02: Domain d1fc2d2: 1fc2 D:342-444

Lineage for d1fc2d2 (1fc2 D:342-444)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (28 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1fc2d2: 1fc2 D:342-444 [21517]
   Other proteins in same PDB: d1fc2c_, d1fc2d1
   part of a Fc
   complexed with so4

Details for d1fc2d2

PDB Entry: 1fc2, 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution

PDB Compounds: (D:) immunoglobulin fc

SCOPe Domain Sequences for d1fc2d2:

Sequence; same for both SEQRES and ATOM records:

>d1fc2d2 b.1.1.2 (D:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d1fc2d2:

• d1fc2d2 first appeared (with stable ids) in SCOP 1.55
  
• d1fc2d2 appears in SCOPe 2.01
  
• d1fc2d2 appears in SCOPe 2.03
  
• d1fc2d2 appears in the current release, SCOPe 2.08