SCOP 1.61: Domain d1fc2d2: 1fc2 D:342-444

Lineage for d1fc2d2 (1fc2 D:342-444)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fc (human) IgG1 class [49120] (9 PDB entries)

8. Domain d1fc2d2: 1fc2 D:342-444 [21517]
   Other proteins in same PDB: d1fc2c_

Details for d1fc2d2

PDB Entry: 1fc2, 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution

SCOP Domain Sequences for d1fc2d2:

Sequence; same for both SEQRES and ATOM records:

>d1fc2d2 b.1.1.2 (D:342-444) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d1fc2d2:

• d1fc2d2 first appeared (with stable ids) in SCOP 1.55
  
• d1fc2d2 appears in SCOP 1.59
  
• d1fc2d2 appears in SCOP 1.63
  
• d1fc2d2 appears in the current release, SCOPe 2.08