Lineage for d3qctl1 (3qct L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512901Domain d3qctl1: 3qct L:1-107 [215169]
    Other proteins in same PDB: d3qctl2
    automated match to d1t66c1
    complexed with pge, so4

Details for d3qctl1

PDB Entry: 3qct (more details), 2.15 Å

PDB Description: crystal structure of the humanized apo lt3015 anti-lysophosphatidic acid antibody fab fragment
PDB Compounds: (L:) LT3015 antibody Fab fragment, light chain

SCOPe Domain Sequences for d3qctl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qctl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleik

SCOPe Domain Coordinates for d3qctl1:

Click to download the PDB-style file with coordinates for d3qctl1.
(The format of our PDB-style files is described here.)

Timeline for d3qctl1: