Lineage for d1fc2d1 (1fc2 D:238-341)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785903Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 785904Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
    Uniprot P01857 #118-327
    Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 785932Domain d1fc2d1: 1fc2 D:238-341 [21516]
    Other proteins in same PDB: d1fc2c_, d1fc2d2
    part of a Fc
    complexed with fuc, gal, man, nag, so4

Details for d1fc2d1

PDB Entry: 1fc2 (more details), 2.8 Å

PDB Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
PDB Compounds: (D:) fragment b of protein a complex

SCOP Domain Sequences for d1fc2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc2d1 b.1.1.2 (D:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1fc2d1:

Click to download the PDB-style file with coordinates for d1fc2d1.
(The format of our PDB-style files is described here.)

Timeline for d1fc2d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc2d2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fc2c_