| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Fc (human) IgG1 class [49120] (6 PDB entries) |
| Domain d1fc2d1: 1fc2 D:238-341 [21516] Other proteins in same PDB: d1fc2c_ |
PDB Entry: 1fc2 (more details), 2.8 Å
SCOP Domain Sequences for d1fc2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc2d1 b.1.1.2 (D:238-341) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1fc2d1: