SCOP 1.61: Domain d1dn2b2: 1dn2 B:342-443

Lineage for d1dn2b2 (1dn2 B:342-443)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fc (human) IgG1 class [49120] (9 PDB entries)

8. Domain d1dn2b2: 1dn2 B:342-443 [21515]

Details for d1dn2b2

PDB Entry: 1dn2, 2.7 Å

PDB Description: fc fragment of human igg1 in complex with an engineered 13 residue peptide dcawhlgelvwct-nh2

SCOP Domain Sequences for d1dn2b2:

Sequence; same for both SEQRES and ATOM records:

>d1dn2b2 b.1.1.2 (B:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1dn2b2:

• d1dn2b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dn2b2 appears in SCOP 1.59
  
• d1dn2b2 appears in SCOP 1.63
  
• d1dn2b2 appears in the current release, SCOPe 2.08