Lineage for d3qbpd_ (3qbp D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010466Species Mycobacterium marinum [TaxId:216594] [226063] (1 PDB entry)
  8. 2010470Domain d3qbpd_: 3qbp D: [215146]
    automated match to d1vdka_

Details for d3qbpd_

PDB Entry: 3qbp (more details), 1.85 Å

PDB Description: crystal structure of fumarase fum from mycobacterium marinum
PDB Compounds: (D:) Fumarase Fum

SCOPe Domain Sequences for d3qbpd_:

Sequence, based on SEQRES records: (download)

>d3qbpd_ a.127.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
vpakalwraqtqravenfpisgrgleraqiralgllkgacaqvnmdlgllapekaeaiia
aaaeiadgqhddqfpidvfqtgsgtssnmntneviasiagangvavhpnddvnmsqssnd
tfptathiaateaavshlipaleilqdalatkalewqsvvksgrthlmdavpvtlgqefs
gyarqieagiervratlprlgelaiggtavgtglnapegfgvkvvsvlvsqtglpqlrta
ansfeaqaardglveasgalrtiavsltkiandirwmgsgpltglaeiqlpdlqpgssim
pgkvnpvlpeavtqvaaqvigndaavawggangafelnvyipmmarnilesftlltnvsk
lfaqrciagltanaehlrelaesspsivtplnsaigyeeaaavakqalkerktirqtvid
rgligdklsleeldrrldvlamakve

Sequence, based on observed residues (ATOM records): (download)

>d3qbpd_ a.127.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
vpakalwraqtqravenfpisgrgleraqiralgllkgacaqvnmdlgllapekaeaiia
aaaeiadgqhddqfpidvfqtgsgtssnmntneviasiagangvavhpnddvnmsqssnd
tfptathiaateaavshlipaleilqdalatkalewqsvvksgrthlmdavpvtlgqefs
gyarqieagiervratlprlgelaiggtavgtglnapegfgvkvvsvlvsqtglpqlrta
ansfeaqaardglveasgalrtiavsltkiandirwmgsgpltglaeiqlpdlkvnpvlp
eavtqvaaqvigndaavawggangafelnvyipmmarnilesftlltnvsklfaqrciag
ltanaehlrelaesspsivtplnsaigyeeaaavakqalkerktirqtvidrgligdkls
leeldrrldvlamakve

SCOPe Domain Coordinates for d3qbpd_:

Click to download the PDB-style file with coordinates for d3qbpd_.
(The format of our PDB-style files is described here.)

Timeline for d3qbpd_: