Lineage for d3qanc_ (3qan C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387939Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1387940Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1388324Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1388325Protein automated matches [190683] (29 species)
    not a true protein
  7. 1388338Species Bacillus halodurans [TaxId:86665] [226069] (1 PDB entry)
  8. 1388341Domain d3qanc_: 3qan C: [215138]
    automated match to d1uzba_
    complexed with act

Details for d3qanc_

PDB Entry: 3qan (more details), 1.95 Å

PDB Description: Crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from bacillus halodurans
PDB Compounds: (C:) 1-pyrroline-5-carboxylate dehydrogenase 1

SCOPe Domain Sequences for d3qanc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qanc_ c.82.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 86665]}
lqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnparkd
qlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawlvh
eagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtispw
nfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsgaev
gdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrdadl
dlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnymgp
videkafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifgpv
vafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaivgy
hpfggfkmsgtdskaggpdylalhmqaktvsemya

SCOPe Domain Coordinates for d3qanc_:

Click to download the PDB-style file with coordinates for d3qanc_.
(The format of our PDB-style files is described here.)

Timeline for d3qanc_: