![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries) |
![]() | Domain d3qanc1: 3qan C:2-515 [215138] Other proteins in same PDB: d3qana2, d3qanb2, d3qanc2 automated match to d1uzba_ complexed with act |
PDB Entry: 3qan (more details), 1.95 Å
SCOPe Domain Sequences for d3qanc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qanc1 c.82.1.0 (C:2-515) automated matches {Bacillus halodurans [TaxId: 86665]} lqpykhepftdftveanrkafeealglvekelgkeypliingervttedkiqswnparkd qlvgsvskanqdlaekaiqsadeafqtwrnvnpeeranilvkaaaiirrrkhefsawlvh eagkpwkeadadtaeaidfleyyarqmielnrgkeilsrpgeqnryfytpmgvtvtispw nfalaimvgtavapivtgntvvlkpasttpvvaakfvevledaglpkgvinyvpgsgaev gdylvdhpktslitftgskdvgvrlyeraavvrpgqnhlkrvivemggkdtvvvdrdadl dlaaesilvsafgfsgqkcsagsravihkdvydevlektvalaknltvgdptnrdnymgp videkafekimsyieigkkegrlmtggegdsstgffiqptiiadldpeavimqeeifgpv vafskandfdhaleiannteygltgavitrnrahieqakrefhvgnlyfnrnctgaivgy hpfggfkmsgtdskaggpdylalhmqaktvsemy
Timeline for d3qanc1:
![]() Domains from other chains: (mouse over for more information) d3qana1, d3qana2, d3qanb1, d3qanb2 |