Lineage for d3qaha_ (3qah A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969117Domain d3qaha_: 3qah A: [215135]
    automated match to d2ou2a_
    complexed with zn

Details for d3qaha_

PDB Entry: 3qah (more details), 2.1 Å

PDB Description: Crystal structure of apo-form human MOF catalytic domain
PDB Compounds: (A:) Probable histone acetyltransferase MYST1

SCOPe Domain Sequences for d3qaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qaha_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwrqp
pgkeiyrksnisvyevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdrqg
ahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekplsd
lgklsyrsywswvlleilrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqhvi
cvtpklveehlksaqykkppitvdsvclkwappk

SCOPe Domain Coordinates for d3qaha_:

Click to download the PDB-style file with coordinates for d3qaha_.
(The format of our PDB-style files is described here.)

Timeline for d3qaha_: