Lineage for d3q9sa2 (3q9s A:123-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695333Species Deinococcus radiodurans [TaxId:1299] [226279] (2 PDB entries)
  8. 2695336Domain d3q9sa2: 3q9s A:123-212 [215134]
    Other proteins in same PDB: d3q9sa1
    automated match to d1kgsa1

Details for d3q9sa2

PDB Entry: 3q9s (more details), 2.4 Å

PDB Description: Crystal structure of rra(1-215) from Deinococcus Radiodurans
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d3q9sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9sa2 a.4.6.0 (A:123-212) automated matches {Deinococcus radiodurans [TaxId: 1299]}
seslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrl
pegsnvvdvhmanlraklrdldgygllrtv

SCOPe Domain Coordinates for d3q9sa2:

Click to download the PDB-style file with coordinates for d3q9sa2.
(The format of our PDB-style files is described here.)

Timeline for d3q9sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q9sa1