Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226278] (1 PDB entry) |
Domain d3q9sa1: 3q9s A:3-122 [215133] Other proteins in same PDB: d3q9sa2 automated match to d1kgsa2 |
PDB Entry: 3q9s (more details), 2.4 Å
SCOPe Domain Sequences for d3q9sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9sa1 c.23.1.0 (A:3-122) automated matches {Deinococcus radiodurans [TaxId: 1299]} eqrilvieddhdianvlrmdltdagyvvdhadsamnglikaredhpdlilldlglpdfdg gdvvqrlrknsalpiivltardtveekvrllglgaddylikpfhpdellarvkvqlrqrt
Timeline for d3q9sa1: