Lineage for d3q9sa1 (3q9s A:3-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855925Species Deinococcus radiodurans [TaxId:1299] [226278] (1 PDB entry)
  8. 2855926Domain d3q9sa1: 3q9s A:3-122 [215133]
    Other proteins in same PDB: d3q9sa2
    automated match to d1kgsa2

Details for d3q9sa1

PDB Entry: 3q9s (more details), 2.4 Å

PDB Description: Crystal structure of rra(1-215) from Deinococcus Radiodurans
PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d3q9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9sa1 c.23.1.0 (A:3-122) automated matches {Deinococcus radiodurans [TaxId: 1299]}
eqrilvieddhdianvlrmdltdagyvvdhadsamnglikaredhpdlilldlglpdfdg
gdvvqrlrknsalpiivltardtveekvrllglgaddylikpfhpdellarvkvqlrqrt

SCOPe Domain Coordinates for d3q9sa1:

Click to download the PDB-style file with coordinates for d3q9sa1.
(The format of our PDB-style files is described here.)

Timeline for d3q9sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q9sa2