Lineage for d3q8yh_ (3q8y H:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651587Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1651588Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1651832Protein automated matches [190032] (13 species)
    not a true protein
  7. 1652003Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries)
  8. 1652033Domain d3q8yh_: 3q8y H: [215130]
    automated match to d3q83f_
    complexed with adp, mg, vo4

Details for d3q8yh_

PDB Entry: 3q8y (more details), 2.7 Å

PDB Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with ADP and Vanadate
PDB Compounds: (H:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3q8yh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q8yh_ d.58.6.1 (H:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye

SCOPe Domain Coordinates for d3q8yh_:

Click to download the PDB-style file with coordinates for d3q8yh_.
(The format of our PDB-style files is described here.)

Timeline for d3q8yh_: