![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries) |
![]() | Domain d3q8vh_: 3q8v H: [215122] automated match to d3q83f_ complexed with mg, udp |
PDB Entry: 3q8v (more details), 2.5 Å
SCOPe Domain Sequences for d3q8vh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q8vh_ d.58.6.1 (H:) automated matches {Staphylococcus aureus [TaxId: 93062]} mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl esaereinlwfneneitsyasprdawlye
Timeline for d3q8vh_: