Lineage for d3q8vf_ (3q8v F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951547Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries)
  8. 2951567Domain d3q8vf_: 3q8v F: [215120]
    automated match to d3q83f_
    complexed with mg, udp

Details for d3q8vf_

PDB Entry: 3q8v (more details), 2.5 Å

PDB Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with UDP
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3q8vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q8vf_ d.58.6.1 (F:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye

SCOPe Domain Coordinates for d3q8vf_:

Click to download the PDB-style file with coordinates for d3q8vf_.
(The format of our PDB-style files is described here.)

Timeline for d3q8vf_: