SCOPe 2.04: Domain d3q8ud_: 3q8u D:

Lineage for d3q8ud_ (3q8u D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [196295] (6 PDB entries)

8. Domain d3q8ud_: 3q8u D: [215112]
   automated match to d3q83f_
   complexed with adp, mg

Details for d3q8ud_

PDB Entry: 3q8u, 2.22 Å

PDB Description: Crystal structure of Staphylococcus aureus nucleoside diphosphate kinase complexed with ADP

PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3q8ud_:

Sequence; same for both SEQRES and ATOM records:

>d3q8ud_ d.58.6.1 (D:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mertflmikpdavqrnligevisrierkglklvggklmqvpmelaethygehqgkpfynd
lisfitsapvfamvvegedavnvsrhiigstnpseaspgsirgdlgltvgrniihgsdsl
esaereinlwfneneitsyasprdawlye

Timeline for d3q8ud_:

• d3q8ud_ first appeared in SCOPe 2.03
  
• d3q8ud_ appears in SCOPe 2.05
  
• d3q8ud_ appears in the current release, SCOPe 2.08