SCOP 1.69: Domain d1b6db2: 1b6d B:108-212

Lineage for d1b6db2 (1b6d B:108-212)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1b6db2: 1b6d B:108-212 [21511]
   Other proteins in same PDB: d1b6da1, d1b6db1
   part of Bence-Jones protein DEL

Details for d1b6db2

PDB Entry: 1b6d, 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6db2:

Sequence; same for both SEQRES and ATOM records:

>d1b6db2 b.1.1.2 (B:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1b6db2:

• d1b6db2 first appeared (with stable ids) in SCOP 1.55
  
• d1b6db2 appears in SCOP 1.67
  
• d1b6db2 appears in SCOP 1.71
  
• d1b6db2 appears in the current release, SCOPe 2.07