Lineage for d3q8ga2 (3q8g A:95-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852202Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2852238Family c.13.1.0: automated matches [227225] (1 protein)
    not a true family
  6. 2852239Protein automated matches [226966] (3 species)
    not a true protein
  7. 2852240Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225409] (5 PDB entries)
  8. 2852241Domain d3q8ga2: 3q8g A:95-309 [215108]
    Other proteins in same PDB: d3q8ga1
    automated match to d1auaa2
    complexed with gol, pee

Details for d3q8ga2

PDB Entry: 3q8g (more details), 1.8 Å

PDB Description: Resurrection of a functional phosphatidylinositol transfer protein from a pseudo-Sec14 scaffold by directed evolution
PDB Compounds: (A:) CRAL-TRIO domain-containing protein YKL091C

SCOPe Domain Sequences for d3q8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q8ga2 c.13.1.0 (A:95-309) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
keaedkeriklakmypqyyhhvdkdgrplyfaelgginlkkmykittekqmlrnlvkeye
lfatyrvpacsrragylietsctvldlkgislsnayhvlsyikdvadisqnyypermgkf
yiihspfgfstmfkmvkpfldpvtvskifilgssykkellkqipienlpvkyggtsvlhn
pndkfyysdigpwrdpryigpegeipnifgkftvt

SCOPe Domain Coordinates for d3q8ga2:

Click to download the PDB-style file with coordinates for d3q8ga2.
(The format of our PDB-style files is described here.)

Timeline for d3q8ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q8ga1