Lineage for d1b6da2 (1b6d A:108-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786055Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
    SQ NA # humanized antibody
    Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
    SQ P01834 # KAC_HUMAN Ig kappa chain C region.
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 786186Domain d1b6da2: 1b6d A:108-212 [21510]
    Other proteins in same PDB: d1b6da1, d1b6db1
    part of Bence-Jones protein DEL

Details for d1b6da2

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer
PDB Compounds: (A:) immunoglobulin

SCOP Domain Sequences for d1b6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6da2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1b6da2:

Click to download the PDB-style file with coordinates for d1b6da2.
(The format of our PDB-style files is described here.)

Timeline for d1b6da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6da1