SCOPe 2.08: Domain d3q74a2: 3q74 A:81-209

Lineage for d3q74a2 (3q74 A:81-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d3q74a2: 3q74 A:81-209 [215093]
   Other proteins in same PDB: d3q74a1, d3q74b1
   automated match to d1agsa1
   mutant

Details for d3q74a2

PDB Entry: 3q74, 1.79 Å

PDB Description: Crystal Structure Analysis of the L7A Mutant of the Apo Form of Human Alpha Class Glutathione Transferase

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d3q74a2:

Sequence; same for both SEQRES and ATOM records:

>d3q74a2 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Timeline for d3q74a2:

• d3q74a2 first appeared in SCOPe 2.03
  
• d3q74a2 appears in SCOPe 2.07