SCOPe 2.08: Domain d3q6wa1: 3q6w A:1050-1348

Lineage for d3q6wa1 (3q6w A:1050-1348)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
   PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries)

8. Domain d3q6wa1: 3q6w A:1050-1348 [215091]
   Other proteins in same PDB: d3q6wa2
   automated match to d3dkga_
   complexed with q6w

Details for d3q6wa1

PDB Entry: 3q6w, 1.75 Å

PDB Description: structure of dually-phosphorylated met receptor kinase in complex with an mk-2461 analog with specificity for the activated receptor

PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3q6wa1:

Sequence, based on SEQRES records:

>d3q6wa1 d.144.1.7 (A:1050-1348) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh

Sequence, based on observed residues (ATOM records):

>d3q6wa1 d.144.1.7 (A:1050-1348) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
ydkeyysvhnklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfdit
vyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh

Timeline for d3q6wa1:

• d3q6wa1 first appeared in SCOPe 2.03, called d3q6wa_
  
• d3q6wa1 appears in SCOPe 2.07