Lineage for d3q6ua_ (3q6u A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930627Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1930628Species Human (Homo sapiens) [TaxId:9606] [103301] (38 PDB entries)
  8. 1930633Domain d3q6ua_: 3q6u A: [215088]
    automated match to d3dkga_

Details for d3q6ua_

PDB Entry: 3q6u (more details), 1.6 Å

PDB Description: Structure of the apo MET receptor kinase in the dually-phosphorylated, activated state
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3q6ua_:

Sequence, based on SEQRES records: (download)

>d3q6ua_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
ehhhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d3q6ua_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
xqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglp
vkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpe
ycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehhhhhhh

SCOPe Domain Coordinates for d3q6ua_:

Click to download the PDB-style file with coordinates for d3q6ua_.
(The format of our PDB-style files is described here.)

Timeline for d3q6ua_: