Lineage for d3q6jb3 (3q6j B:384-523)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569563Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase [82726] (1 species)
  7. 2569564Species Xanthobacter sp., py2 [TaxId:35809] [82727] (5 PDB entries)
  8. 2569568Domain d3q6jb3: 3q6j B:384-523 [215087]
    Other proteins in same PDB: d3q6ja1, d3q6ja2, d3q6jb1, d3q6jb2
    automated match to d1mo9a3
    complexed with acn, bct, co2, com, fad, kpc, mg, nap

Details for d3q6jb3

PDB Entry: 3q6j (more details), 1.92 Å

PDB Description: Structural basis for carbon dioxide binding by 2-ketopropyl coenzyme M Oxidoreductase/Carboxylase
PDB Compounds: (B:) 2-oxopropyl-CoM reductase, carboxylating

SCOPe Domain Sequences for d3q6jb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6jb3 d.87.1.1 (B:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}
pknypdflhthyevsflgmgeeearaagheivtikmppdtenglnvalpasdrtmlyafg
kgtahmsgfqkividaktrkvlgahhvgygakdafqylnvlikqgltvdelgdmdelfln
pthfiqlsrlragsknlvsl

SCOPe Domain Coordinates for d3q6jb3:

Click to download the PDB-style file with coordinates for d3q6jb3.
(The format of our PDB-style files is described here.)

Timeline for d3q6jb3: