Lineage for d3q6ja1 (3q6j A:2-192,A:314-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850109Protein NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain [418948] (1 species)
  7. 2850110Species Xanthobacter sp., py2 [TaxId:35809] [419404] (5 PDB entries)
  8. 2850113Domain d3q6ja1: 3q6j A:2-192,A:314-383 [215082]
    Other proteins in same PDB: d3q6ja2, d3q6ja3, d3q6jb2, d3q6jb3
    automated match to d1mo9a1
    complexed with acn, bct, co2, com, fad, kpc, mg, nap

    has additional insertions and/or extensions that are not grouped together

Details for d3q6ja1

PDB Entry: 3q6j (more details), 1.92 Å

PDB Description: Structural basis for carbon dioxide binding by 2-ketopropyl coenzyme M Oxidoreductase/Carboxylase
PDB Compounds: (A:) 2-oxopropyl-CoM reductase, carboxylating

SCOPe Domain Sequences for d3q6ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6ja1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase, N- and C-terminal domain {Xanthobacter sp., py2 [TaxId: 35809]}
kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
vgagpgtldvpXeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
fkarksgcyaarnvmgekisyt

SCOPe Domain Coordinates for d3q6ja1:

Click to download the PDB-style file with coordinates for d3q6ja1.
(The format of our PDB-style files is described here.)

Timeline for d3q6ja1: