SCOPe 2.02: Domain d1mcwm2: 1mcw M:112-216

Lineage for d1mcwm2 (1mcw M:112-216)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d1mcwm2: 1mcw M:112-216 [21508]
   Other proteins in same PDB: d1mcwm1, d1mcww1
   part of heterologous L chain dimer MCG-WEIR

Details for d1mcwm2

PDB Entry: 1mcw, 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity

PDB Compounds: (M:) immunoglobulin mcg (light chain)

SCOPe Domain Sequences for d1mcwm2:

Sequence; same for both SEQRES and ATOM records:

>d1mcwm2 b.1.1.2 (M:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mcwm2:

• d1mcwm2 first appeared (with stable ids) in SCOP 1.55
  
• d1mcwm2 appears in SCOPe 2.01
  
• d1mcwm2 appears in SCOPe 2.03
  
• d1mcwm2 appears in the current release, SCOPe 2.08