SCOPe 2.08: Domain d3q6gl2: 3q6g L:108-208

Lineage for d3q6gl2 (3q6g L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d3q6gl2: 3q6g L:108-208 [215079]
   Other proteins in same PDB: d3q6gh_, d3q6gi_, d3q6gl1, d3q6gm1
   automated match to d1w72l2

Details for d3q6gl2

PDB Entry: 3q6g, 1.9 Å

PDB Description: Crystal structure of Fab of rhesus mAb 2.5B specific for quaternary neutralizing epitope of HIV-1 gp120

PDB Compounds: (L:) Light chain of Fab of rhesus mAb 2.5B

SCOPe Domain Sequences for d3q6gl2:

Sequence; same for both SEQRES and ATOM records:

>d3q6gl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkaapsvtlfppsseelqankatlvclisdfypgavevawkadgsavnagvettkpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvap

Timeline for d3q6gl2:

• d3q6gl2 first appeared in SCOPe 2.03
  
• d3q6gl2 appears in SCOPe 2.07