Lineage for d3q5yd2 (3q5y D:118-246)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752471Domain d3q5yd2: 3q5y D:118-246 [215077]
    Other proteins in same PDB: d3q5ya1, d3q5yb1, d3q5yc1, d3q5yd1
    automated match to d1lp9f2
    complexed with epe, gol, peg

Details for d3q5yd2

PDB Entry: 3q5y (more details), 1.9 Å

PDB Description: V beta/V beta homodimerization-based pre-TCR model suggested by TCR beta crystal structures
PDB Compounds: (D:) TCR N15 beta

SCOPe Domain Sequences for d3q5yd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5yd2 b.1.1.2 (D:118-246) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOPe Domain Coordinates for d3q5yd2:

Click to download the PDB-style file with coordinates for d3q5yd2.
(The format of our PDB-style files is described here.)

Timeline for d3q5yd2: