Lineage for d3q5ta2 (3q5t A:116-240)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2363997Domain d3q5ta2: 3q5t A:116-240 [215069]
    Other proteins in same PDB: d3q5ta1
    automated match to d1lp9f2

Details for d3q5ta2

PDB Entry: 3q5t (more details), 2 Å

PDB Description: v beta/v beta homodimerization-based pre-tcr model suggested by tcr beta crystal structures
PDB Compounds: (A:) TCR N30 beta

SCOPe Domain Sequences for d3q5ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5ta2 b.1.1.2 (A:116-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOPe Domain Coordinates for d3q5ta2:

Click to download the PDB-style file with coordinates for d3q5ta2.
(The format of our PDB-style files is described here.)

Timeline for d3q5ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q5ta1