SCOPe 2.05: Domain d3q5ta2: 3q5t A:116-240

Lineage for d3q5ta2 (3q5t A:116-240)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3q5ta2: 3q5t A:116-240 [215069]
   Other proteins in same PDB: d3q5ta1
   automated match to d1lp9f2

Details for d3q5ta2

PDB Entry: 3q5t, 2 Å

PDB Description: v beta/v beta homodimerization-based pre-tcr model suggested by tcr beta crystal structures

PDB Compounds: (A:) TCR N30 beta

SCOPe Domain Sequences for d3q5ta2:

Sequence; same for both SEQRES and ATOM records:

>d3q5ta2 b.1.1.2 (A:116-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

Timeline for d3q5ta2:

• d3q5ta2 first appeared in SCOPe 2.03
  
• d3q5ta2 appears in SCOPe 2.04
  
• d3q5ta2 appears in SCOPe 2.06
  
• d3q5ta2 appears in the current release, SCOPe 2.08