Lineage for d3q5lb1 (3q5l B:1-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973723Species Leishmania major [TaxId:347515] [195250] (5 PDB entries)
  8. 2973729Domain d3q5lb1: 3q5l B:1-208 [215065]
    Other proteins in same PDB: d3q5la2, d3q5lb2, d3q5lc2, d3q5ld2
    automated match to d3u67a_
    complexed with kx2

Details for d3q5lb1

PDB Entry: 3q5l (more details), 2.65 Å

PDB Description: crystal structure of the amino-terminal domain of hsp90 from leishmania major, lmjf33.0312:m1-k 213 in the presence of 17-aep- geldanamycin
PDB Compounds: (B:) Heat shock protein 83-1

SCOPe Domain Sequences for d3q5lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5lb1 d.122.1.1 (B:1-208) automated matches {Leishmania major [TaxId: 347515]}
mtetfafqaeinqlmsliintfysnkeiflrelisnasdacdkiryqsltdpsvlgespr
lcirvvpdkenktltvedngigmtkadlvnnlgtiarsgtkafmealeaggdmsmigqfg
vgfysaylvadrvtvtsknnsdesyvwessaggtftitstpesdmkrgtritlhlkedqm
eyleprrlkelikkhsefigydielmve

SCOPe Domain Coordinates for d3q5lb1:

Click to download the PDB-style file with coordinates for d3q5lb1.
(The format of our PDB-style files is described here.)

Timeline for d3q5lb1: